PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco019514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family BBR-BPC
Protein Properties Length: 393aa    MW: 44006.2 Da    PI: 10.4277
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco019514.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind360.92.5e-1108639215301
    GAGA_bind  15 epaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvenslasalpvgvqvlsgtksidslq 112
                   p++++ke+ +++l+++++erd++i+ernla+sekkaa+aerdma +qrd+a+aer+ a++erd++++al+l+++s ++ ++++ +  ++ ++ ++  
  Aco019514.1  86 MPQHQMKEHHTMKLIALMTERDTAIQERNLAISEKKAALAERDMAIMQRDTAIAERDSAIIERDDAIAALELARESGMNGNAKNLHNHQHNHQHHNNL 183
                  36779*******************************************************************99997766644444433333333222 PP

    GAGA_bind 113 qlse.....pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader.................. 186
                           pql+d +++ +re++++ea+pi+ a e+  +++k+k++++++k+++  + + k +s  ++k+++  ++d +                  
  Aco019514.1 184 S--VvqpspPQLSDAPYDhVREMHIMEAYPISAALENDMKARKPKQTRKESKAQAAPSPSMKSSS--KRKSKRVGGDDLNssqvtiakthhnggggvk 277
                  2..234688*********9*****************99999999966666665555555555544..444444444443335799999*********9 PP

    GAGA_bind 187 skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvD 284
                  +k+e+k++dl+ln+v++Dest+PvPvCsCtG+ r CYkWGnGGWqS+CCttt+S+yPLPv++++r+aR++grKmS++af+klL+++aaeG+dls pvD
  Aco019514.1 278 KKNEWKDQDLGLNQVTFDESTMPVPVCSCTGKFRPCYKWGNGGWQSSCCTTTLSMYPLPVMANKRHARMGGRKMSGSAFSKLLSRVAAEGHDLSMPVD 375
                  9************************************************************************************************* PP

    GAGA_bind 285 LkdhWAkHGtnkfvtir 301
                  LkdhWAkHGtn+++ti+
  Aco019514.1 376 LKDHWAKHGTNRYITIK 392
                  ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.7E-12268392IPR010409GAGA-binding transcriptional activator
PfamPF062171.1E-9685392IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MTADIGRTGD RGLTNINQFT HRKLFFTIPG SFLYIPFFRA TYSGHKKSIG AKKWRKLGTF  60
HAHCRQLHFH HGTSRKCISS EHSVMMPQHQ MKEHHTMKLI ALMTERDTAI QERNLAISEK  120
KAALAERDMA IMQRDTAIAE RDSAIIERDD AIAALELARE SGMNGNAKNL HNHQHNHQHH  180
NNLSVVQPSP PQLSDAPYDH VREMHIMEAY PISAALENDM KARKPKQTRK ESKAQAAPSP  240
SMKSSSKRKS KRVGGDDLNS SQVTIAKTHH NGGGGVKKKN EWKDQDLGLN QVTFDESTMP  300
VPVCSCTGKF RPCYKWGNGG WQSSCCTTTL SMYPLPVMAN KRHARMGGRK MSGSAFSKLL  360
SRVAAEGHDL SMPVDLKDHW AKHGTNRYIT IK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008776335.11e-141PREDICTED: barley B recombinant-like protein D isoform X2
RefseqXP_008776336.11e-141PREDICTED: barley B recombinant-like protein D isoform X2
RefseqXP_008776337.11e-141PREDICTED: barley B recombinant-like protein D isoform X2
SwissprotQ5VSA81e-128BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLC5Z3A81e-132C5Z3A8_SORBI; Putative uncharacterized protein Sb10g002020
STRINGSb10g002020.11e-131(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62263756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.22e-96basic pentacysteine 6